AFG3L2 anticorps

N° du produit ABIN635053

Détail du produit anti-AFG3L2 anticorps

Antigène: AFG3L2 (AFG3-Like Protein 2 (AFG3L2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AFG3L2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AFG3 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AFG3L2 Blocking Peptide, catalog no. 33R-9704, is also available for use as a blocking control in assays to test for specificity of this AFG3L2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFG0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AFG3L2

Antigène: AFG3L2 (AFG3-Like Protein 2 (AFG3L2))

Autre désignation: AFG3L2 (AFG3L2 Produits)

Synonymes: anticorps MGC147390, anticorps si:ch211-12e1.4, anticorps SCA28, anticorps SPAX5, anticorps 2310036I02Rik, anticorps AW260507, anticorps Emv66, anticorps par, anticorps AFG3 like matrix AAA peptidase subunit 2, anticorps AFG3-like protein 2, anticorps AFG3 ATPase family gene 3-like 2 (S. cerevisiae), anticorps AFG3-like AAA ATPase 2, anticorps AFG3-like AAA ATPase 2 L homeolog, anticorps AFG3L2, anticorps LOC578526, anticorps afg3l2, anticorps afg3l2.L, anticorps Afg3l2

Sujet: AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development