SLC25A20 anticorps

N° du produit ABIN635058

Détail du produit anti-SLC25A20 anticorps

Antigène: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A20 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC25 A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A20 Blocking Peptide, catalog no. 33R-3287, is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A20

Antigène: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Autre désignation: SLC25A20 (SLC25A20 Produits)

Synonymes: anticorps 5848, anticorps BG:DS02740.15, anticorps CACT, anticorps CG5848, anticorps Cact, anticorps Dmel\\CG5848, anticorps cac, anticorps dip6, anticorps fs(2)ltoRN48, anticorps n(2)k17003, anticorps cact, anticorps dif-1, anticorps SLC25A20, anticorps DKFZp468F1219, anticorps zgc:77760, anticorps PRKAR2A, anticorps CAC, anticorps 1110007P09Rik, anticorps C78826, anticorps mCAC, anticorps cactus, anticorps solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, anticorps solute carrier family 25 member 20, anticorps solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 L homeolog, anticorps solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20, anticorps cact, anticorps slc25a20, anticorps SLC25A20, anticorps Slc25a20, anticorps slc25a20.L

Sujet: SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.It mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: TCR Signaling, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades