SLC25A11 anticorps
-
- Antigène Voir toutes SLC25A11 Anticorps
- SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A11 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM
- Top Product
- Discover our top product SLC25A11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A11 Blocking Peptide, catalog no. 33R-1955, is also available for use as a blocking control in assays to test for specificity of this SLC25A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))
- Autre désignation
- SLC25A11 (SLC25A11 Produits)
- Synonymes
- anticorps SLC25A11, anticorps 2310022P18Rik, anticorps 2oxoc, anticorps fa07h09, anticorps wu:fa07h09, anticorps zgc:86898, anticorps OGC, anticorps SLC20A4, anticorps solute carrier family 25 member 11, anticorps solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11, anticorps solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11, anticorps solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 L homeolog, anticorps SLC25A11, anticorps Slc25a11, anticorps slc25a11, anticorps slc25a11.L
- Sujet
- SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-