COX18 anticorps
-
- Antigène Voir toutes COX18 Anticorps
- COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COX18 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR
- Top Product
- Discover our top product COX18 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
COX18 Blocking Peptide, catalog no. 33R-4833, is also available for use as a blocking control in assays to test for specificity of this COX18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))
- Autre désignation
- COX18 (COX18 Produits)
- Synonymes
- anticorps COX18HS, anticorps BC038311, anticorps RGD1559547, anticorps COX18 cytochrome c oxidase assembly factor L homeolog, anticorps COX18, cytochrome c oxidase assembly factor, anticorps cytochrome c oxidase assembly protein 18, anticorps cox18.L, anticorps COX18, anticorps Cox18
- Sujet
- COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.
- Poids moléculaire
- 37 kDa (MW of target protein)
-