OR5T2 anticorps (C-Term)

N° du produit ABIN635104

Détail du produit anti-OR5T2 anticorps

Antigène: OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OR5T2 est non-conjugé

Application: Western Blotting (WB)

Specificité: OR5 T2 antibody was raised against the C terminal of OR5 2

Purification: Affinity purified

Immunogène: OR5 T2 antibody was raised using the C terminal of OR5 2 corresponding to a region with amino acids DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OR5T2 Blocking Peptide, catalog no. 33R-2075, is also available for use as a blocking control in assays to test for specificity of this OR5T2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OR5T2

Antigène: OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))

Autre désignation: OR5T2 (OR5T2 Produits)

Synonymes: anticorps OR11-177, anticorps olfactory receptor family 5 subfamily T member 2, anticorps olfactory receptor, family 5, subfamily T, member 2, anticorps olfactory receptor 1086-like, anticorps OR5T2, anticorps LOC100727026

Sujet: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Poids moléculaire: 39 kDa (MW of target protein)