SLC18A2 anticorps
-
- Antigène Voir toutes SLC18A2 Anticorps
- SLC18A2 (Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC18A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC18 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
- Top Product
- Discover our top product SLC18A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC18A2 Blocking Peptide, catalog no. 33R-6646, is also available for use as a blocking control in assays to test for specificity of this SLC18A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC18A2 (Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2))
- Autre désignation
- SLC18A2 (SLC18A2 Produits)
- Synonymes
- anticorps 1110037L13Rik, anticorps 9330105E13, anticorps VAT2, anticorps Vmat2, anticorps MNAT, anticorps VMAT-2, anticorps VMAT2, anticorps solute carrier family 18 (vesicular monoamine), member 2, anticorps solute carrier family 18 member A2, anticorps Slc18a2
- Sujet
- The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
- Poids moléculaire
- 56 kDa (MW of target protein)
-