OR11H12 anticorps (N-Term)

N° du produit ABIN635110

Détail du produit anti-OR11H12 anticorps

Antigène: OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OR11H12 est non-conjugé

Application: Western Blotting (WB)

Specificité: OR11 H12 antibody was raised against the N terminal of OR11 12

Purification: Affinity purified

Immunogène: OR11 H12 antibody was raised using the N terminal of OR11 12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OR11H12 Blocking Peptide, catalog no. 33R-1768, is also available for use as a blocking control in assays to test for specificity of this OR11H12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OR11H12

Antigène: OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))

Autre désignation: OR11H12 (OR11H12 Produits)

Synonymes: anticorps olfactory receptor family 11 subfamily H member 12, anticorps OR11H12

Sujet: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Poids moléculaire: 36 kDa (MW of target protein)