SLC15A4 anticorps (Middle Region)
-
- Antigène Voir toutes SLC15A4 Anticorps
- SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC15A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC15 A4 antibody was raised against the middle region of SLC15 4
- Purification
- Affinity purified
- Immunogène
- SLC15 A4 antibody was raised using the middle region of SLC15 4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
- Top Product
- Discover our top product SLC15A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC15A4 Blocking Peptide, catalog no. 33R-3409, is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))
- Autre désignation
- SLC15A4 (SLC15A4 Produits)
- Synonymes
- anticorps bZ1L10.1, anticorps zgc:56484, anticorps zgc:63767, anticorps pht1, anticorps ptr4, anticorps MGC80026, anticorps PHT1, anticorps PTR4, anticorps AA987064, anticorps AW742963, anticorps C130069N12Rik, anticorps solute carrier family 15 (oligopeptide transporter), member 4, anticorps solute carrier family 15 member 4, anticorps solute carrier family 15 member 4 L homeolog, anticorps solute carrier family 15, member 4, anticorps slc15a4, anticorps SLC15A4, anticorps slc15a4.L, anticorps Slc15a4
- Sujet
- SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
- Poids moléculaire
- 62 kDa (MW of target protein)
-