ATP6V0C anticorps (Middle Region)

N° du produit ABIN635137

Détail du produit anti-ATP6V0C anticorps

Antigène: ATP6V0C (ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V0C est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 antibody was raised against the middle region of ATP6 6

Purification: Affinity purified

Immunogène: ATP6 V6 antibody was raised using the middle region of ATP6 6 corresponding to a region with amino acids VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V0C Blocking Peptide, catalog no. 33R-9868, is also available for use as a blocking control in assays to test for specificity of this ATP6V0C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V0C

Antigène: ATP6V0C (ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C))

Autre désignation: ATP6V0C (ATP6V0C Produits)

Synonymes: anticorps ATP6C, anticorps ATP6L, anticorps ATPL, anticorps VATL, anticorps VPPC, anticorps Vma3, anticorps Atp6c, anticorps Atp6c2, anticorps Atp6l, anticorps Atpl, anticorps Atpl-rs1, anticorps PL16, anticorps CHUNP6904, anticorps atp6l, anticorps atp6v0c, anticorps cb993, anticorps fb57d09, anticorps wu:fb57d09, anticorps atp6c, anticorps atpl, anticorps ductin, anticorps vatl, anticorps vma3, anticorps PLP, anticorps wu:fc74d11, anticorps zgc:111904, anticorps zgc:77708, anticorps ATPase H+ transporting V0 subunit c, anticorps ATPase, H+ transporting, lysosomal V0 subunit C, anticorps ATPase H+ transporting V0 subunit C, anticorps ATPase, H+ transporting, lysosomal, V0 subunit ca, anticorps ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, anticorps ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c L homeolog, anticorps V-type proton ATPase 16 kDa proteolipid subunit, anticorps ATPase, H+ transporting, lysosomal, V0 subunit cb, anticorps ATP6V0C, anticorps Atp6v0c, anticorps atp6v0ca, anticorps atp6v0c, anticorps atp6v0c.L, anticorps LOC696755, anticorps atp6v0cb

Sujet: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport