DLG3 anticorps

N° du produit ABIN635177

Détail du produit anti-DLG3 anticorps

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLG3 Blocking Peptide, catalog no. 33R-3722, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLG3

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Autre désignation: DLG3 (DLG3 Produits)

Synonymes: anticorps MRX, anticorps MRX90, anticorps NEDLG, anticorps SAP102, anticorps XLMR, anticorps DLG3, anticorps fa66c08, anticorps fa66e02, anticorps fd02c12, anticorps fu95c12, anticorps im:7138640, anticorps si:ch211-276g21.1, anticorps wu:fa66c08, anticorps wu:fa66e02, anticorps wu:fd02c12, anticorps wu:fu95c12, anticorps Dlgh3, anticorps mKIAA1232, anticorps MPP3, anticorps 6430514B01, anticorps CSG18, anticorps Dlg3, anticorps Dusp3, anticorps discs large MAGUK scaffold protein 3, anticorps membrane palmitoylated protein 3, anticorps discs, large homolog 3 (Drosophila), anticorps membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3), anticorps DLG3, anticorps MPP3, anticorps dlg3, anticorps Dlg3, anticorps Mpp3

Sujet: DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).

Poids moléculaire: 58 kDa (MW of target protein)