LPPR5 anticorps (N-Term)

N° du produit ABIN635195

Détail du produit anti-LPPR5 anticorps

Antigène: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LPPR5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PAP2 D antibody was raised against the N terminal of PAP2

Purification: Affinity purified

Immunogène: PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LPPR5

Antigène: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Autre désignation: PAP2D (LPPR5 Produits)

Synonymes: anticorps PAP2, anticorps PAP2D, anticorps PRG5, anticorps Lppr5, anticorps PRG-5, anticorps Pap2d, anticorps RGD1309567, anticorps LPPR5, anticorps lppr5b, anticorps zgc:165526, anticorps phospholipid phosphatase related 5, anticorps phospholipid phosphatase related 5 L homeolog, anticorps phospholipid phosphatase related 5b, anticorps PLPPR5, anticorps Plppr5, anticorps plppr5.L, anticorps plppr5b

Sujet: PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Poids moléculaire: 35 kDa (MW of target protein)