MPZL1 anticorps (Middle Region)

N° du produit ABIN635201

Détail du produit anti-MPZL1 anticorps

Antigène: MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPZL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MPZL1 antibody was raised against the middle region of MPZL1

Purification: Affinity purified

Immunogène: MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPZL1 Blocking Peptide, catalog no. 33R-4168, is also available for use as a blocking control in assays to test for specificity of this MPZL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPZL1

Antigène: MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))

Autre désignation: MPZL1 (MPZL1 Produits)

Synonymes: anticorps MPZL1, anticorps MPZL1b, anticorps PZR, anticorps PZR1b, anticorps PZRa, anticorps PZRb, anticorps 1110007A10Rik, anticorps myelin protein zero like 1, anticorps myelin protein zero-like 1, anticorps MPZL1, anticorps Mpzl1

Sujet: MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2.

Poids moléculaire: 23 kDa (MW of target protein)