RHBDF1 anticorps

N° du produit ABIN635205

Détail du produit anti-RHBDF1 anticorps

Antigène: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHBDF1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHBDF1 Blocking Peptide, catalog no. 33R-4310, is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHBDF1

Antigène: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Autre désignation: RHBDF1 (RHBDF1 Produits)

Synonymes: anticorps zgc:91984, anticorps C16orf8, anticorps Dist1, anticorps EGFR-RS, anticorps gene-89, anticorps gene-90, anticorps hDist1, anticorps C16ORF8, anticorps Dist, anticorps Egfr-rs, anticorps mKIAA4242, anticorps rhomboid 5 homolog 1, anticorps rhomboid 5 homolog 1a (Drosophila), anticorps RHBDF1, anticorps rhbdf1, anticorps rhbdf1a, anticorps Rhbdf1

Sujet: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Growth Factor Binding