TRAF3IP3 anticorps (Middle Region)

N° du produit ABIN635207

Détail du produit anti-TRAF3IP3 anticorps

Antigène: TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAF3IP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAF3 IP3 antibody was raised against the middle region of TRAF3 P3

Purification: Affinity purified

Immunogène: TRAF3 IP3 antibody was raised using the middle region of TRAF3 P3 corresponding to a region with amino acids KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAF3IP3 Blocking Peptide, catalog no. 33R-4606, is also available for use as a blocking control in assays to test for specificity of this TRAF3IP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAF3IP3

Antigène: TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))

Autre désignation: TRAF3IP3 (TRAF3IP3 Produits)

Synonymes: anticorps DJ434O14.3, anticorps T3JAM, anticorps 6030423D04Rik, anticorps AI115021, anticorps T3jam, anticorps RGD1304848, anticorps TRAF3 interacting protein 3, anticorps TRAF3IP3, anticorps Traf3ip3

Sujet: TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.

Poids moléculaire: 61 kDa (MW of target protein)