C-Type Lectin Domain Family 6, Member A (CLEC6A) (N-Term) anticorps

N° du produit ABIN635219

Détail du produit

Antigène: C-Type Lectin Domain Family 6, Member A (CLEC6A)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: CLEC6 A antibody was raised against the N terminal of CLEC6

Purification: Affinity purified

Immunogène: CLEC6 A antibody was raised using the N terminal of CLEC6 corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLEC6A Blocking Peptide, catalog no. 33R-2939, is also available for use as a blocking control in assays to test for specificity of this CLEC6A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: C-Type Lectin Domain Family 6, Member A (CLEC6A)

Autre désignation: CLEC6A (CLEC6A Produits)

Synonymes: anticorps CLEC4N, anticorps CLECSF10, anticorps CLEC6A, anticorps C-type lectin domain containing 6A, anticorps C-type lectin domain family 6, member A, anticorps CLEC6A, anticorps Clec6a

Sujet: CLEC6A may be involved in regulating immune reactivity.

Poids moléculaire: 24 kDa (MW of target protein)