LTB anticorps

N° du produit ABIN635263

Détail du produit anti-LTB anticorps

Antigène: LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LTB est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LTB Blocking Peptide, catalog no. 33R-1610, is also available for use as a blocking control in assays to test for specificity of this LTB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LTB

Antigène: LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))

Autre désignation: LTB (LTB Produits)

Synonymes: anticorps AI662801, anticorps LTbeta, anticorps Tnfc, anticorps Tnfsf3, anticorps p33, anticorps TNFC, anticorps TNFSF3, anticorps LT-b, anticorps LT-beta, anticorps TNF-C, anticorps lymphotoxin B, anticorps lymphotoxin beta, anticorps Ltb, anticorps LTB

Sujet: Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB