SLC5A5 anticorps
-
- Antigène Voir toutes SLC5A5 Anticorps
- SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC5A5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC5 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
- Top Product
- Discover our top product SLC5A5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC5A5 Blocking Peptide, catalog no. 33R-8989, is also available for use as a blocking control in assays to test for specificity of this SLC5A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))
- Autre désignation
- SLC5A5 (SLC5A5 Produits)
- Synonymes
- anticorps Na(+)/I(-) cotransporter, anticorps Na(+)/I(-) symporter, anticorps Nis, anticorps solute carrier family 5 member 5, anticorps Slc5a5
- Sujet
- The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
- Poids moléculaire
- 69 kDa (MW of target protein)
-