ENPP2 anticorps (N-Term)

N° du produit ABIN635340

Détail du produit anti-ENPP2 anticorps

Antigène: ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENPP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ENPP2 antibody was raised against the N terminal of ENPP2

Purification: Affinity purified

Immunogène: ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENPP2

Antigène: ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))

Autre désignation: ENPP2 (ENPP2 Produits)

Sujet: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.

Poids moléculaire: 95 kDa (MW of target protein)