OR6C68 anticorps (N-Term)

N° du produit ABIN635347

Détail du produit anti-OR6C68 anticorps

Antigène: OR6C68 (Olfactory Receptor, Family 6, Subfamily C, Member 68 (OR6C68))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OR6C68 est non-conjugé

Application: Western Blotting (WB)

Specificité: OR6 C68 antibody was raised against the N terminal of OR6 68

Purification: Affinity purified

Immunogène: OR6 C68 antibody was raised using the N terminal of OR6 68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OR6C68 Blocking Peptide, catalog no. 33R-6330, is also available for use as a blocking control in assays to test for specificity of this OR6C68 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 68 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OR6C68

Antigène: OR6C68 (Olfactory Receptor, Family 6, Subfamily C, Member 68 (OR6C68))

Autre désignation: OR6C68 (OR6C68 Produits)

Synonymes: anticorps olfactory receptor family 6 subfamily C member 68, anticorps OR6C68

Sujet: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Poids moléculaire: 36 kDa (MW of target protein)