ATP1B4 anticorps

N° du produit ABIN635356

Détail du produit anti-ATP1B4 anticorps

Antigène: ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP1B4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ATP1 B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP1B4 Blocking Peptide, catalog no. 33R-1078, is also available for use as a blocking control in assays to test for specificity of this ATP1B4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP1B4

Antigène: ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))

Autre désignation: ATP1B4 (ATP1B4 Produits)

Synonymes: anticorps 1110020B02Rik, anticorps Ac2-628, anticorps ATPase, (Na+)/K+ transporting, beta 4 polypeptide, anticorps ATPase Na+/K+ transporting family member beta 4, anticorps ATPase, Na+/K+ transporting, beta 4 polypeptide L homeolog, anticorps Atp1b4, anticorps ATP1B4, anticorps atp1b4.L

Sujet: This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Proton Transport