SLC17A4 anticorps
-
- Antigène Voir toutes SLC17A4 Anticorps
- SLC17A4 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC17A4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- SLC17 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL
- Top Product
- Discover our top product SLC17A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC17A4 Blocking Peptide, catalog no. 33R-10092, is also available for use as a blocking control in assays to test for specificity of this SLC17A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC17A4 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4))
- Autre désignation
- SLC17A4 (SLC17A4 Produits)
- Synonymes
- anticorps SLC17A4, anticorps 9130214H05Rik, anticorps KAIA2138, anticorps solute carrier family 17 member 4, anticorps solute carrier family 17 member 3, anticorps solute carrier family 17 (sodium phosphate), member 4, anticorps solute carrier family 17, member 4, anticorps SLC17A4, anticorps SLC17A3, anticorps Slc17a4
- Sujet
- As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.
- Poids moléculaire
- 55 kDa (MW of target protein)
-