NHE8 anticorps

N° du produit ABIN635374

Détail du produit anti-NHE8 anticorps

Antigène: NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NHE8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC9 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC9A8 Blocking Peptide, catalog no. 33R-1315, is also available for use as a blocking control in assays to test for specificity of this SLC9A8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NHE8

Antigène: NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))

Autre désignation: SLC9A8 (SLC9A8 Produits)

Synonymes: anticorps 1200006P13Rik, anticorps 6430709P13Rik, anticorps AI182282, anticorps NHE8, anticorps nhe8, anticorps wu:fj61b02, anticorps zgc:103660, anticorps NHE-8, anticorps solute carrier family 9 member A8, anticorps solute carrier family 9 member 8, anticorps solute carrier family 9 (sodium/hydrogen exchanger), member 8, anticorps solute carrier family 9, subfamily A (NHE8, cation proton antiporter 8), member 8, anticorps SLC9A8, anticorps slc9a8, anticorps Slc9a8

Sujet: Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Proton Transport