SLC22A17 anticorps (Middle Region)
-
- Antigène Voir toutes SLC22A17 Anticorps
- SLC22A17 (Solute Carrier Family 22 (Organic Cation Transporter), Member 17 (SLC22A17))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A17 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC22 A17 antibody was raised against the middle region of SLC22 17
- Purification
- Affinity purified
- Immunogène
- SLC22 A17 antibody was raised using the middle region of SLC22 17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM
- Top Product
- Discover our top product SLC22A17 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A17 Blocking Peptide, catalog no. 33R-3704, is also available for use as a blocking control in assays to test for specificity of this SLC22A17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A17 (Solute Carrier Family 22 (Organic Cation Transporter), Member 17 (SLC22A17))
- Autre désignation
- SLC22A17 (SLC22A17 Produits)
- Synonymes
- anticorps 1700094C23Rik, anticorps 24p3R, anticorps AU041908, anticorps AW555662, anticorps BOIT, anticorps Boct, anticorps mBOCT, anticorps BOCT, anticorps NGALR, anticorps NGALR2, anticorps NGALR3, anticorps hBOIT, anticorps rBOCT, anticorps solute carrier family 22 member 17, anticorps solute carrier family 22 (organic cation transporter), member 17, anticorps solute carrier family 22, member 17, anticorps SLC22A17, anticorps Slc22a17
- Sujet
- The function of SLC22A17 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-