SLC12A8 anticorps

N° du produit ABIN635376

Détail du produit anti-SLC12A8 anticorps

Antigène: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC12A8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC12A8 Blocking Peptide, catalog no. 33R-4006, is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC12A8

Antigène: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Autre désignation: SLC12A8 (Slc12a8 Produits)

Synonymes: anticorps CCC9, anticorps E330020C02Rik, anticorps Ccc9, anticorps solute carrier family 12 member 8, anticorps zinc finger protein 148, anticorps solute carrier family 12 (potassium/chloride transporters), member 8, anticorps solute carrier family 12, member 8, anticorps solute carrier family 12, member 8 L homeolog, anticorps SLC12A8, anticorps ZNF148, anticorps Slc12a8, anticorps slc12a8.L

Sujet: SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.

Poids moléculaire: 78 kDa (MW of target protein)