GLT8D1 anticorps (Middle Region)

N° du produit ABIN635397

Détail du produit anti-GLT8D1 anticorps

Antigène: GLT8D1 (Glycosyltransferase 8 Domain Containing 1 (GLT8D1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLT8D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLT8 D1 antibody was raised against the middle region of GLT8 1

Purification: Affinity purified

Immunogène: GLT8 D1 antibody was raised using the middle region of GLT8 1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLT8D1 Blocking Peptide, catalog no. 33R-5151, is also available for use as a blocking control in assays to test for specificity of this GLT8D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLT8D1

Antigène: GLT8D1 (Glycosyltransferase 8 Domain Containing 1 (GLT8D1))

Autre désignation: GLT8D1 (GLT8D1 Produits)

Synonymes: anticorps MSTP139, anticorps 2410004H05Rik, anticorps 5430414N14Rik, anticorps AI450005, anticorps Da2-24, anticorps wu:fc60b12, anticorps zgc:103525, anticorps glycosyltransferase 8 domain containing 1, anticorps glycosyltransferase 8 domain containing 1 L homeolog, anticorps GLT8D1, anticorps Glt8d1, anticorps glt8d1, anticorps glt8d1.L

Sujet: GLT8D1 is a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described.

Poids moléculaire: 42 kDa (MW of target protein)