SPINT1 anticorps (Middle Region)

N° du produit ABIN635406

Détail du produit anti-SPINT1 anticorps

Antigène: SPINT1 (serine Peptidase Inhibitor, Kunitz Type 1 (SPINT1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPINT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPINT1 antibody was raised against the middle region of SPINT1

Purification: Affinity purified

Immunogène: SPINT1 antibody was raised using the middle region of SPINT1 corresponding to a region with amino acids PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPINT1 Blocking Peptide, catalog no. 33R-7084, is also available for use as a blocking control in assays to test for specificity of this SPINT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPINT1

Antigène: SPINT1 (serine Peptidase Inhibitor, Kunitz Type 1 (SPINT1))

Autre désignation: SPINT1 (SPINT1 Produits)

Synonymes: anticorps HAI-1, anticorps HAI, anticorps HAI1, anticorps MANSC2, anticorps cb376, anticorps sb:cb376, anticorps spint1l, anticorps zgc:64075, anticorps serine peptidase inhibitor, Kunitz type 1, anticorps serine protease inhibitor, Kunitz type 1, anticorps serine peptidase inhibitor, Kunitz type 1 b, anticorps serine peptidase inhibitor, Kunitz type 1 a, anticorps SPINT1, anticorps Spint1, anticorps spint1b, anticorps spint1a

Sujet: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF.

Poids moléculaire: 53 kDa (MW of target protein)