Integrin beta 5 anticorps (Middle Region)

N° du produit ABIN635415

Détail du produit anti-Integrin beta 5 anticorps

Antigène: Integrin beta 5 (ITGB5)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Integrin beta 5 est non-conjugé

Application: Western Blotting (WB)

Specificité: Integrin Beta 5 antibody was raised against the middle region of ITGB5

Purification: Affinity purified

Immunogène: Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Integrin beta 5

Antigène: Integrin beta 5 (ITGB5)

Autre désignation: Integrin beta 5 (ITGB5 Produits)

Synonymes: anticorps ITGB5, anticorps AA475909, anticorps AI874634, anticorps ESTM23, anticorps [b]-5, anticorps [b]5, anticorps [b]5A, anticorps [b]5B, anticorps beta-5, anticorps beta5, anticorps RGD1563276, anticorps integrin, beta 5, anticorps integrin beta 5, anticorps integrin subunit beta 5, anticorps ITGB5, anticorps Itgb5

Sujet: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: Integrin Complex