ITGA8 anticorps (N-Term)

N° du produit ABIN635422

Détail du produit anti-ITGA8 anticorps

Antigène: ITGA8 (Integrin alpha-8 (ITGA8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGA8 est non-conjugé

Application: Western Blotting (WB)

Specificité: Integrin Alpha 8 antibody was raised against the N terminal of ITGA8

Purification: Affinity purified

Immunogène: Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Integrin Alpha 8 Blocking Peptide, catalog no. 33R-3233, is also available for use as a blocking control in assays to test for specificity of this Integrin Alpha 8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGA8

Antigène: ITGA8 (Integrin alpha-8 (ITGA8))

Autre désignation: Integrin alpha 8 (ITGA8 Produits)

Synonymes: anticorps AI447669, anticorps RGD1564327, anticorps integrin alpha 8, anticorps integrin subunit alpha 8, anticorps Itga8, anticorps ITGA8

Sujet: Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.

Poids moléculaire: 117 kDa (MW of target protein)