CHIC2 anticorps (N-Term)

N° du produit ABIN635437

Détail du produit anti-CHIC2 anticorps

Antigène: CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHIC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHIC2 antibody was raised against the N terminal of CHIC2

Purification: Affinity purified

Immunogène: CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHIC2 Blocking Peptide, catalog no. 33R-5620, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHIC2

Antigène: CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))

Autre désignation: CHIC2 (CHIC2 Produits)

Synonymes: anticorps zgc:55670, anticorps BTL, anticorps 1700081B18Rik, anticorps 4930502K01Rik, anticorps cysteine rich hydrophobic domain 2, anticorps cysteine-rich hydrophobic domain 2, anticorps cysteine rich hydrophobic domain 2 S homeolog, anticorps CHIC2, anticorps CpipJ_CPIJ013126, anticorps chic2, anticorps chic2.S, anticorps Chic2

Sujet: CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.

Poids moléculaire: 19 kDa (MW of target protein)