ATP4b anticorps (Middle Region)

N° du produit ABIN635524

Détail du produit anti-ATP4b anticorps

Antigène: ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP4b est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP4 B antibody was raised against the middle region of ATP4

Purification: Affinity purified

Immunogène: ATP4 B antibody was raised using the middle region of ATP4 corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP4B Blocking Peptide, catalog no. 33R-7776, is also available for use as a blocking control in assays to test for specificity of this ATP4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP4b

Antigène: ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))

Autre désignation: ATP4B (ATP4b Produits)

Synonymes: anticorps AV080843, anticorps S76401S1, anticorps ATP6B, anticorps ATPase, H+/K+ exchanging, beta polypeptide, anticorps ATPase H+/K+ transporting beta subunit, anticorps ATPase, H+/K+ exchanging, beta polypeptide S homeolog, anticorps ATPase H+/K+ transporting alpha subunit, anticorps Atp4b, anticorps atp4b.S, anticorps ATP4B, anticorps ATP4A

Sujet: ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Proton Transport