ABCC1 anticorps
-
- Antigène Voir toutes ABCC1 Anticorps
- ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA
- Top Product
- Discover our top product ABCC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCC1 Blocking Peptide, catalog no. 33R-4941, is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))
- Autre désignation
- ABCC1 (ABCC1 Produits)
- Sujet
- ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.
- Poids moléculaire
- 171 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-