CYP4V2 anticorps (Middle Region)
-
- Antigène Voir toutes CYP4V2 Anticorps
- CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP4V2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP4 V2 antibody was raised against the middle region of CYP4 2
- Purification
- Affinity purified
- Immunogène
- CYP4 V2 antibody was raised using the middle region of CYP4 2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
- Top Product
- Discover our top product CYP4V2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP4V2 Blocking Peptide, catalog no. 33R-8274, is also available for use as a blocking control in assays to test for specificity of this CYP4V2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))
- Autre désignation
- CYP4V2 (CYP4V2 Produits)
- Synonymes
- anticorps BCD, anticorps CYP4AH1, anticorps CYP4V, anticorps bcd, anticorps cyp4ah1, anticorps MGC147146, anticorps cytochrome P450 family 4 subfamily V member 2, anticorps cytochrome P450 family 4 subfamily V member 2 S homeolog, anticorps cytochrome P450, family 4, subfamily V, polypeptide 2, anticorps cytochrome P450, family 4, subfamily v, polypeptide 2, anticorps CYP4V2, anticorps cyp4v2.S, anticorps cyp4v2
- Sujet
- This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy.
- Poids moléculaire
- 61 kDa (MW of target protein)
-