CYP4V2 anticorps (Middle Region)

N° du produit ABIN635585

Détail du produit anti-CYP4V2 anticorps

Antigène: CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP4V2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP4 V2 antibody was raised against the middle region of CYP4 2

Purification: Affinity purified

Immunogène: CYP4 V2 antibody was raised using the middle region of CYP4 2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP4V2 Blocking Peptide, catalog no. 33R-8274, is also available for use as a blocking control in assays to test for specificity of this CYP4V2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP4V2

Antigène: CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))

Autre désignation: CYP4V2 (CYP4V2 Produits)

Synonymes: anticorps BCD, anticorps CYP4AH1, anticorps CYP4V, anticorps bcd, anticorps cyp4ah1, anticorps MGC147146, anticorps cytochrome P450 family 4 subfamily V member 2, anticorps cytochrome P450 family 4 subfamily V member 2 S homeolog, anticorps cytochrome P450, family 4, subfamily V, polypeptide 2, anticorps cytochrome P450, family 4, subfamily v, polypeptide 2, anticorps CYP4V2, anticorps cyp4v2.S, anticorps cyp4v2

Sujet: This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy.

Poids moléculaire: 61 kDa (MW of target protein)