SLC14A1 anticorps (C-Term)
-
- Antigène Voir toutes SLC14A1 Anticorps
- SLC14A1 (Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC14A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SLC14 A1 antibody was raised against the C terminal of SLC14 1
- Purification
- Affinity purified
- Immunogène
- SLC14 A1 antibody was raised using the C terminal of SLC14 1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
- Top Product
- Discover our top product SLC14A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC14A1 Blocking Peptide, catalog no. 33R-5455, is also available for use as a blocking control in assays to test for specificity of this SLC14A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC14A1 (Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1))
- Autre désignation
- SLC14A1 (SLC14A1 Produits)
- Synonymes
- anticorps HUT11, anticorps HsT1341, anticorps JK, anticorps RACH1, anticorps RACH2, anticorps UT-B1, anticorps UT1, anticorps UTE, anticorps 2610507K20Rik, anticorps 3021401A05Rik, anticorps UT-B, anticorps Utb1, anticorps UT3, anticorps UTB1, anticorps UrT2, anticorps UT-1, anticorps solute carrier family 14 member 1 (Kidd blood group), anticorps solute carrier family 14 (urea transporter), member 1, anticorps solute carrier family 14 member 1, anticorps SLC14A1, anticorps Slc14a1
- Sujet
- SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.
- Poids moléculaire
- 42 kDa (MW of target protein)
-