SLC6A2 anticorps
-
- Antigène Voir toutes SLC6A2 Anticorps
- SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC6A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC6 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
- Top Product
- Discover our top product SLC6A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC6A2 Blocking Peptide, catalog no. 33R-8875, is also available for use as a blocking control in assays to test for specificity of this SLC6A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))
- Autre désignation
- SLC6A2 (SLC6A2 Produits)
- Synonymes
- anticorps NAT1, anticorps NET, anticorps NET1, anticorps SLC6A5, anticorps NE-T, anticorps Slc6a5, anticorps Net, anticorps SLC6A2, anticorps solute carrier family 6 member 2, anticorps solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, anticorps solute carrier family 6 member 5, anticorps SLC6A2, anticorps Slc6a2, anticorps SLC6A5
- Sujet
- The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.
- Poids moléculaire
- 69 kDa (MW of target protein)
-