ATP5G2 anticorps
-
- Antigène Voir toutes ATP5G2 Anticorps
- ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP5G2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ATP5 G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA
- Top Product
- Discover our top product ATP5G2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP5G2 Blocking Peptide, catalog no. 33R-8767, is also available for use as a blocking control in assays to test for specificity of this ATP5G2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))
- Autre désignation
- ATP5G2 (ATP5G2 Produits)
- Sujet
- ATP5G2 is a subunit of mitochondrial ATP synthase.
- Poids moléculaire
- 8 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-