WNT1 anticorps (Middle Region)

N° du produit ABIN635697

Détail du produit anti-WNT1 anticorps

Antigène: WNT1 (Wingless-Type MMTV Integration Site Family, Member 1 (WNT1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT1 antibody was raised against the middle region of WNT1

Purification: Affinity purified

Immunogène: WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT1 Blocking Peptide, catalog no. 33R-2912, is also available for use as a blocking control in assays to test for specificity of this WNT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT1

Antigène: WNT1 (Wingless-Type MMTV Integration Site Family, Member 1 (WNT1))

Autre désignation: WNT1 (WNT1 Produits)

Synonymes: anticorps Xint-1, anticorps Xwnt1, anticorps int-1, anticorps int1, anticorps wnt-1, anticorps wnt1-a, anticorps Int-1, anticorps Wnt-1, anticorps sw, anticorps swaying, anticorps BMND16, anticorps INT1, anticorps OI15, anticorps Int1, anticorps WNT-1, anticorps sb:eu647, anticorps zgc:194464, anticorps zgc:194478, anticorps WNT1, anticorps Wnt family member 1, anticorps Wnt family member 1 L homeolog, anticorps wingless-type MMTV integration site family, member 1, anticorps WNT1, anticorps wnt1.L, anticorps Wnt1, anticorps wnt1

Sujet: WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Signalisation WNT, Dopaminergic Neurogenesis