CYP46A1 anticorps (C-Term)

N° du produit ABIN635703

Détail du produit anti-CYP46A1 anticorps

Antigène: CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP46A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP46 A1 antibody was raised against the C terminal of CYP46 1

Purification: Affinity purified

Immunogène: CYP46 A1 antibody was raised using the C terminal of CYP46 1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP46A1 Blocking Peptide, catalog no. 33R-10280, is also available for use as a blocking control in assays to test for specificity of this CYP46A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP46A1

Antigène: CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))

Autre désignation: CYP46A1 (CYP46A1 Produits)

Synonymes: anticorps CP46, anticorps CYP46, anticorps CYP46A1, anticorps zgc:109896, anticorps MGC147389, anticorps Cyp46, anticorps cytochrome P450 family 46 subfamily A member 1, anticorps cytochrome P450 family 46 subfamily A member 1 L homeolog, anticorps cytochrome P450, family 46, subfamily A, polypeptide 1, tandem duplicate 1, anticorps cytochrome P450, family 46, anticorps cytochrome P450 46A1, anticorps cytochrome P450, family 46, subfamily a, polypeptide 1, anticorps cholesterol 24-hydroxylase, anticorps cytochrome P450, family 46, subfamily A, polypeptide 1, anticorps CYP46A1, anticorps cyp46a1.L, anticorps cyp46a1.1, anticorps cyp46a1, anticorps PTRG_08343, anticorps PTRG_09667, anticorps Cyp46a1, anticorps Sgly_1093

Sujet: CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Poids moléculaire: 57 kDa (MW of target protein)