Reticulon 4 anticorps (Middle Region)
-
- Antigène Voir toutes Reticulon 4 (RTN4) Anticorps
- Reticulon 4 (RTN4)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Reticulon 4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RTN4 antibody was raised against the middle region of RTN4
- Purification
- Affinity purified
- Immunogène
- RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
- Top Product
- Discover our top product RTN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RTN4 Blocking Peptide, catalog no. 33R-3051, is also available for use as a blocking control in assays to test for specificity of this RTN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Reticulon 4 (RTN4)
- Autre désignation
- RTN4 (RTN4 Produits)
- Synonymes
- anticorps ASY, anticorps NI220/250, anticorps NOGO, anticorps NOGO-A, anticorps NOGOC, anticorps NSP, anticorps NSP-CL, anticorps Nbla00271, anticorps Nbla10545, anticorps Nogo-B, anticorps Nogo-C, anticorps RTN-X, anticorps RTN4-A, anticorps RTN4-B1, anticorps RTN4-B2, anticorps RTN4-C, anticorps RTN4-Cw, anticorps DKFZp459C0314, anticorps 1110020G17Rik, anticorps AA407876, anticorps AA409940, anticorps AA960376, anticorps C130026I10Rik, anticorps NgA, anticorps Nogo-A, anticorps mKIAA0886, anticorps mKIAA4153, anticorps NI-250, anticorps Nogo, anticorps Vp20, anticorps r, anticorps rat N, anticorps rat NogoA, anticorps reticulon-4, anticorps nogo, anticorps rtn4, anticorps wu:fb17a02, anticorps wu:fb22f12, anticorps wu:fd61a07, anticorps zgc:92163, anticorps reticulon 4, anticorps reticulon 4a, anticorps RTN4, anticorps rtn4, anticorps Rtn4, anticorps rtn4a
- Sujet
- RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, Regulation of Cell Size, SARS-CoV-2 Protein Interactome
-