LRFN3 anticorps (C-Term)

N° du produit ABIN635732

Détail du produit anti-LRFN3 anticorps

Antigène: LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRFN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRFN3 antibody was raised against the C terminal of LRFN3

Purification: Affinity purified

Immunogène: LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRFN3 Blocking Peptide, catalog no. 33R-9926, is also available for use as a blocking control in assays to test for specificity of this LRFN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRFN3

Antigène: LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))

Autre désignation: LRFN3 (LRFN3 Produits)

Sujet: LRFN3 belongs to the LRFN family. Its exact function remains unknown.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Synaptic Membrane