B3GALT1 anticorps (C-Term)

N° du produit ABIN635750

Détail du produit anti-B3GALT1 anticorps

Antigène: B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GALT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: B3 GALT1 antibody was raised against the C terminal of B3 ALT1

Purification: Affinity purified

Immunogène: B3 GALT1 antibody was raised using the C terminal of B3 ALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GALT1 Blocking Peptide, catalog no. 33R-10158, is also available for use as a blocking control in assays to test for specificity of this B3GALT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GALT1

Antigène: B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))

Autre désignation: B3GALT1 (B3GALT1 Produits)

Synonymes: anticorps beta3Gal-T1, anticorps Beta3GalT1, anticorps beta-1,3-galactosyltransferase 1, anticorps UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1, anticorps Beta-1,3-galactosyltransferase 1, anticorps B3GALT1, anticorps B3galt1

Sujet: B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon.

Poids moléculaire: 38 kDa (MW of target protein)