WNT6 anticorps (Middle Region)
-
- Antigène Voir toutes WNT6 Anticorps
- WNT6 (Wingless-Type MMTV Integration Site Family, Member 6 (WNT6))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WNT6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WNT6 antibody was raised against the middle region of WNT6
- Purification
- Affinity purified
- Immunogène
- WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG
- Top Product
- Discover our top product WNT6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WNT6 Blocking Peptide, catalog no. 33R-2692, is also available for use as a blocking control in assays to test for specificity of this WNT6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WNT6 (Wingless-Type MMTV Integration Site Family, Member 6 (WNT6))
- Autre désignation
- WNT6 (WNT6 Produits)
- Synonymes
- anticorps WNT6, anticorps si:dkey-31m21.2, anticorps Wnt6, anticorps AA409270, anticorps Wnt-6, anticorps Xwnt-6, anticorps wnt-6, anticorps wnt6-A, anticorps xWnt6, anticorps Wnt family member 6, anticorps wingless-type MMTV integration site family, member 6b, anticorps wingless-type MMTV integration site family, member 6, anticorps Wnt family member 6 S homeolog, anticorps WNT6, anticorps Wnt6, anticorps wnt6b, anticorps wnt6.S
- Sujet
- The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Signalisation WNT, Tube Formation
-