FZD2 anticorps

N° du produit ABIN635757

Détail du produit anti-FZD2 anticorps

Antigène: FZD2 (Frizzled Family Receptor 2 (FZD2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FZD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD2 Blocking Peptide, catalog no. 33R-6374, is also available for use as a blocking control in assays to test for specificity of this FZD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD2

Antigène: FZD2 (Frizzled Family Receptor 2 (FZD2))

Autre désignation: FZD2 (FZD2 Produits)

Synonymes: anticorps BG01711, anticorps CG9739, anticorps D-Fz2, anticorps D-fz2, anticorps DFZ2, anticorps DFz-2, anticorps DFz2, anticorps Dfrz2, anticorps Dfz2, anticorps Dfz[[2]], anticorps Dm Fz2, anticorps Dmel\\CG9739, anticorps FZ2, anticorps Fz2, anticorps dFz2, anticorps dfz(2), anticorps dfz2, anticorps dfz2r, anticorps frz2, anticorps fz-2, anticorps fz8, anticorps zfz2, anticorps zg08, anticorps cb383, anticorps wu:fb70g09, anticorps FZD2, anticorps fzE2, anticorps hFz2, anticorps Fz-10, anticorps Fzd10, anticorps cFz-2, anticorps frizzled2, anticorps fz2, anticorps xfz2, anticorps AL033370, anticorps AW456835, anticorps Fz10, anticorps Mfz10, anticorps Mfz10a, anticorps frizzled 2, anticorps frizzled class receptor 2, anticorps frizzled class receptor 2 S homeolog, anticorps fz2, anticorps fzd2, anticorps FZD2, anticorps Fzd2, anticorps fzd2.S

Sujet: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Signalisation WNT