FZD2 anticorps
-
- Antigène Voir toutes FZD2 Anticorps
- FZD2 (Frizzled Family Receptor 2 (FZD2))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FZD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FZD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI
- Top Product
- Discover our top product FZD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FZD2 Blocking Peptide, catalog no. 33R-6374, is also available for use as a blocking control in assays to test for specificity of this FZD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FZD2 (Frizzled Family Receptor 2 (FZD2))
- Autre désignation
- FZD2 (FZD2 Produits)
- Synonymes
- anticorps BG01711, anticorps CG9739, anticorps D-Fz2, anticorps D-fz2, anticorps DFZ2, anticorps DFz-2, anticorps DFz2, anticorps Dfrz2, anticorps Dfz2, anticorps Dfz[[2]], anticorps Dm Fz2, anticorps Dmel\\CG9739, anticorps FZ2, anticorps Fz2, anticorps dFz2, anticorps dfz(2), anticorps dfz2, anticorps dfz2r, anticorps frz2, anticorps fz-2, anticorps fz8, anticorps zfz2, anticorps zg08, anticorps cb383, anticorps wu:fb70g09, anticorps FZD2, anticorps fzE2, anticorps hFz2, anticorps Fz-10, anticorps Fzd10, anticorps cFz-2, anticorps frizzled2, anticorps fz2, anticorps xfz2, anticorps AL033370, anticorps AW456835, anticorps Fz10, anticorps Mfz10, anticorps Mfz10a, anticorps frizzled 2, anticorps frizzled class receptor 2, anticorps frizzled class receptor 2 S homeolog, anticorps fz2, anticorps fzd2, anticorps FZD2, anticorps Fzd2, anticorps fzd2.S
- Sujet
- Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.
- Poids moléculaire
- 63 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-