MMP20 anticorps (Middle Region)

N° du produit ABIN635771

Détail du produit anti-MMP20 anticorps

Antigène: MMP20 (Matrix Metalloproteinase 20 (MMP20))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP20 est non-conjugé

Application: Western Blotting (WB)

Specificité: MMP20 antibody was raised against the middle region of MMP20

Purification: Affinity purified

Immunogène: MMP20 antibody was raised using the middle region of MMP20 corresponding to a region with amino acids AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP20 Blocking Peptide, catalog no. 33R-1063, is also available for use as a blocking control in assays to test for specificity of this MMP20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP20

Antigène: MMP20 (Matrix Metalloproteinase 20 (MMP20))

Autre désignation: MMP20 (MMP20 Produits)

Synonymes: anticorps AI2A2, anticorps MMP-20, anticorps MMP25, anticorps MMP20, anticorps mmp20, anticorps matrix metallopeptidase 20, anticorps matrix metallopeptidase 20 L homeolog, anticorps matrix metallopeptidase 20 (enamelysin), anticorps MMP20, anticorps mmp20.L, anticorps Mmp20

Sujet: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.

Poids moléculaire: 43 kDa (MW of target protein)