MMP16 anticorps

N° du produit ABIN635772

Détail du produit anti-MMP16 anticorps

Antigène: MMP16 (Matrix Metallopeptidase 16 (Membrane-inserted) (MMP16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP16 Blocking Peptide, catalog no. 33R-1318, is also available for use as a blocking control in assays to test for specificity of this MMP16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP16

Antigène: MMP16 (Matrix Metallopeptidase 16 (Membrane-inserted) (MMP16))

Autre désignation: MMP16 (MMP16 Produits)

Synonymes: anticorps MT3-MMP, anticorps Mt3mmp, anticorps Mt3-mmp, anticorps C8orf57, anticorps MMP-X2, anticorps MT-MMP2, anticorps MT-MMP3, anticorps matrix metallopeptidase 16, anticorps Mmp16, anticorps MMP16

Sujet: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Poids moléculaire: 56 kDa (MW of target protein)