SLC27A4 anticorps
-
- Antigène Voir toutes SLC27A4 Anticorps
- SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC27A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC27 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
- Top Product
- Discover our top product SLC27A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC27A4 Blocking Peptide, catalog no. 33R-10148, is also available for use as a blocking control in assays to test for specificity of this SLC27A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))
- Autre désignation
- SLC27A4 (SLC27A4 Produits)
- Synonymes
- anticorps SLC27A4, anticorps zgc:112138, anticorps FATP4, anticorps ACSVL4, anticorps IPS, anticorps BB144259, anticorps Fatp4, anticorps solute carrier family 27 member 4, anticorps solute carrier family 27 (fatty acid transporter), member 4, anticorps SLC27A4, anticorps slc27a4, anticorps Slc27a4
- Sujet
- SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
- Poids moléculaire
- 72 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-