WNT9B anticorps (Middle Region)

N° du produit ABIN635819

Détail du produit anti-WNT9B anticorps

Antigène: WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT9B est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT9 B antibody was raised against the middle region of WNT9

Purification: Affinity purified

Immunogène: WNT9 B antibody was raised using the middle region of WNT9 corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT9B Blocking Peptide, catalog no. 33R-1820, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT9B

Antigène: WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))

Autre désignation: WNT9B (WNT9B Produits)

Synonymes: anticorps WNT14B, anticorps WNT15, anticorps WNT9B, anticorps wnt-9b, anticorps Wnt14b, anticorps Wnt15, anticorps clf, anticorps clf1, anticorps wnt-14b, anticorps wnt-15, anticorps Wnt family member 9B, anticorps wingless-type MMTV integration site family member 9B L homeolog, anticorps protein Wnt-9b, anticorps wingless-type MMTV integration site family, member 9B, anticorps WNT9B, anticorps wnt9b.2.L, anticorps Wnt9b, anticorps LOC468296, anticorps wnt9b

Sujet: WNT9B is a ligand for members of the frizzled family of seven transmembrane receptors. WNT9B is a probable developmental protein. WNT9B may be a signaling molecule which affects the development of discrete regions of tissues. WNT9B is likely to signal over only few cell diameters.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Signalisation WNT, Tube Formation