CYP4F12 anticorps (C-Term)

N° du produit ABIN635833

Détail du produit anti-CYP4F12 anticorps

Antigène: CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP4F12 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP4 F12 antibody was raised against the C terminal of CYP4 12

Purification: Affinity purified

Immunogène: CYP4 F12 antibody was raised using the C terminal of CYP4 12 corresponding to a region with amino acids TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP4F12 Blocking Peptide, catalog no. 33R-9377, is also available for use as a blocking control in assays to test for specificity of this CYP4F12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP4F12

Antigène: CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))

Autre désignation: CYP4F12 (CYP4F12 Produits)

Synonymes: anticorps F22329_1, anticorps DKFZp469H0334, anticorps cytochrome P450 family 4 subfamily F member 12, anticorps cytochrome P450, family 4, subfamily F, polypeptide 12, anticorps cytochrome P450 4F12, anticorps CYP4F12, anticorps CpipJ_CPIJ016853, anticorps MCYG_08150

Sujet: CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid, however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process