ACVR1 anticorps (N-Term)

N° du produit ABIN635876

Détail du produit anti-ACVR1 anticorps

Antigène: ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACVR1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ACVR1 antibody was raised against the N terminal of ACVR1

Purification: Affinity purified

Immunogène: ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACVR1 Blocking Peptide, catalog no. 33R-8997, is also available for use as a blocking control in assays to test for specificity of this ACVR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACVR1

Antigène: ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))

Autre désignation: ACVR1 (ACRV1 Produits)

Sujet: Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.

Poids moléculaire: 55 kDa (MW of target protein)