PTPRA anticorps (C-Term)

N° du produit ABIN635883

Détail du produit anti-PTPRA anticorps

Antigène: PTPRA (Protein tyrosine Phosphatase, Receptor Type, A (PTPRA))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTPRA est non-conjugé

Application: Western Blotting (WB)

Specificité: PTPRA antibody was raised against the C terminal of PTPRA

Purification: Affinity purified

Immunogène: PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTPRA Blocking Peptide, catalog no. 33R-8769, is also available for use as a blocking control in assays to test for specificity of this PTPRA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTPRA

Antigène: PTPRA (Protein tyrosine Phosphatase, Receptor Type, A (PTPRA))

Autre désignation: PTPRA (PTPRA Produits)

Synonymes: anticorps PTPRA, anticorps heptp, anticorps hlpr, anticorps hptpa, anticorps hptpalpha, anticorps lrp, anticorps ptpa, anticorps ptprl2, anticorps r-ptp-alpha, anticorps rptpa, anticorps HEPTP, anticorps HLPR, anticorps HPTPA, anticorps HPTPalpha, anticorps LRP, anticorps PTPA, anticorps PTPRL2, anticorps R-PTP-alpha, anticorps RPTPA, anticorps Ptpa, anticorps Ptpalpha, anticorps Rptpalpha, anticorps Rptra, anticorps Rptralpha, anticorps RPTP[a], anticorps zf-RPTP[a], anticorps ptpa-a, anticorps protein tyrosine phosphatase, receptor type A, anticorps protein tyrosine phosphatase, receptor type, A, anticorps protein tyrosine phosphatase, receptor type A S homeolog, anticorps PTPRA, anticorps ptpra, anticorps Ptpra, anticorps ptpra.S

Sujet: PTPRA is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPRA contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. PTPRA has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation.

Poids moléculaire: 89 kDa (MW of target protein)