ALG6 anticorps
-
- Antigène Voir toutes ALG6 Anticorps
- ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALG6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA
- Top Product
- Discover our top product ALG6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALG6 Blocking Peptide, catalog no. 33R-10079, is also available for use as a blocking control in assays to test for specificity of this ALG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))
- Autre désignation
- ALG6 (ALG6 Produits)
- Synonymes
- anticorps CG5091, anticorps Dalg6, anticorps Dmel\\CG5091, anticorps alg6, anticorps zgc:100813, anticorps CDG1C, anticorps E230028F23Rik, anticorps garnysstan, anticorps asparagine-linked glycosylation 6 (alpha-1,3,-glucosyltransferase), anticorps ALG6, alpha-1,3-glucosyltransferase, anticorps ALG6, alpha-1,3-glucosyltransferase S homeolog, anticorps gny, anticorps alg6, anticorps ALG6, anticorps alg6.S, anticorps Alg6
- Sujet
- This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic.
- Poids moléculaire
- 58 kDa (MW of target protein)
-